Review



human antimicrobial peptide ll  (InvivoGen)


Bioz Verified Symbol InvivoGen is a verified supplier
Bioz Manufacturer Symbol InvivoGen manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 95

    Structured Review

    InvivoGen human antimicrobial peptide ll
    Human Antimicrobial Peptide Ll, supplied by InvivoGen, used in various techniques. Bioz Stars score: 95/100, based on 80 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll/product/InvivoGen
    Average 95 stars, based on 80 article reviews
    human antimicrobial peptide ll - by Bioz Stars, 2026-02
    95/100 stars

    Images



    Similar Products

    95
    InvivoGen human antimicrobial peptide ll
    Human Antimicrobial Peptide Ll, supplied by InvivoGen, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll/product/InvivoGen
    Average 95 stars, based on 1 article reviews
    human antimicrobial peptide ll - by Bioz Stars, 2026-02
    95/100 stars
      Buy from Supplier

    90
    AnaSpec human antimicrobial peptide ll-37 as-61302
    Human Antimicrobial Peptide Ll 37 As 61302, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll-37 as-61302/product/AnaSpec
    Average 90 stars, based on 1 article reviews
    human antimicrobial peptide ll-37 as-61302 - by Bioz Stars, 2026-02
    90/100 stars
      Buy from Supplier

    90
    AnaSpec human antimicrobial peptide ll-37
    Human Antimicrobial Peptide Ll 37, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll-37/product/AnaSpec
    Average 90 stars, based on 1 article reviews
    human antimicrobial peptide ll-37 - by Bioz Stars, 2026-02
    90/100 stars
      Buy from Supplier

    90
    AnaSpec human antimicrobial peptide ll-37 anaspec #as-61302
    Human Antimicrobial Peptide Ll 37 Anaspec #As 61302, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll-37 anaspec #as-61302/product/AnaSpec
    Average 90 stars, based on 1 article reviews
    human antimicrobial peptide ll-37 anaspec #as-61302 - by Bioz Stars, 2026-02
    90/100 stars
      Buy from Supplier

    90
    Heumann Pharma human cathelicidin cap18/ll-37-derived antimicrobial peptides
    Human Cathelicidin Cap18/Ll 37 Derived Antimicrobial Peptides, supplied by Heumann Pharma, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human cathelicidin cap18/ll-37-derived antimicrobial peptides/product/Heumann Pharma
    Average 90 stars, based on 1 article reviews
    human cathelicidin cap18/ll-37-derived antimicrobial peptides - by Bioz Stars, 2026-02
    90/100 stars
      Buy from Supplier

    90
    GenScript corporation human antimicrobial peptide ll-37 ([LL-37, 37 aa]
    Human Antimicrobial Peptide Ll 37 ([LL-37, 37 aa], supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll-37 ([LL-37, 37 aa]/product/GenScript corporation
    Average 90 stars, based on 1 article reviews
    human antimicrobial peptide ll-37 ([LL-37, 37 aa] - by Bioz Stars, 2026-02
    90/100 stars
      Buy from Supplier

    90
    Molecular Dynamics Inc dynamics simulations of human antimicrobial peptide ll-37
    Dynamics Simulations Of Human Antimicrobial Peptide Ll 37, supplied by Molecular Dynamics Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/dynamics simulations of human antimicrobial peptide ll-37/product/Molecular Dynamics Inc
    Average 90 stars, based on 1 article reviews
    dynamics simulations of human antimicrobial peptide ll-37 - by Bioz Stars, 2026-02
    90/100 stars
      Buy from Supplier

    92
    Cusabio human cathelicidin antimicrobial peptide ll 37 elisa kit
    The serum level of <t>LL-37</t> is reduced in patients with myocardial infarction. a The serum level of the human cathelicidin LL-37 was measured by ELISA in patients with myocardial infarction (MI, n = 172) and normal controls ( n = 160). b The serum level of LL-37 was measured by ELISA in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. c The serum LL-37/neutrophil ratio was determined in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. d The receiver-operator characteristic (ROC) curve was used to assess the sensitivity and specificity of the serum LL-37/neutrophil ratio in prediction of readmission and/or death in MI patients. Data were expressed as mean ± SEM. * P < 0.05; ** P < 0.01; *** P < 0.001
    Human Cathelicidin Antimicrobial Peptide Ll 37 Elisa Kit, supplied by Cusabio, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human cathelicidin antimicrobial peptide ll 37 elisa kit/product/Cusabio
    Average 92 stars, based on 1 article reviews
    human cathelicidin antimicrobial peptide ll 37 elisa kit - by Bioz Stars, 2026-02
    92/100 stars
      Buy from Supplier

    92
    Tocris synthetic human antimicrobial peptide ll 37
    The serum level of <t>LL-37</t> is reduced in patients with myocardial infarction. a The serum level of the human cathelicidin LL-37 was measured by ELISA in patients with myocardial infarction (MI, n = 172) and normal controls ( n = 160). b The serum level of LL-37 was measured by ELISA in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. c The serum LL-37/neutrophil ratio was determined in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. d The receiver-operator characteristic (ROC) curve was used to assess the sensitivity and specificity of the serum LL-37/neutrophil ratio in prediction of readmission and/or death in MI patients. Data were expressed as mean ± SEM. * P < 0.05; ** P < 0.01; *** P < 0.001
    Synthetic Human Antimicrobial Peptide Ll 37, supplied by Tocris, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/synthetic human antimicrobial peptide ll 37/product/Tocris
    Average 92 stars, based on 1 article reviews
    synthetic human antimicrobial peptide ll 37 - by Bioz Stars, 2026-02
    92/100 stars
      Buy from Supplier

    Image Search Results


    The serum level of LL-37 is reduced in patients with myocardial infarction. a The serum level of the human cathelicidin LL-37 was measured by ELISA in patients with myocardial infarction (MI, n = 172) and normal controls ( n = 160). b The serum level of LL-37 was measured by ELISA in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. c The serum LL-37/neutrophil ratio was determined in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. d The receiver-operator characteristic (ROC) curve was used to assess the sensitivity and specificity of the serum LL-37/neutrophil ratio in prediction of readmission and/or death in MI patients. Data were expressed as mean ± SEM. * P < 0.05; ** P < 0.01; *** P < 0.001

    Journal: BMC Medicine

    Article Title: Cathelicidin-related antimicrobial peptide protects against myocardial ischemia/reperfusion injury

    doi: 10.1186/s12916-019-1268-y

    Figure Lengend Snippet: The serum level of LL-37 is reduced in patients with myocardial infarction. a The serum level of the human cathelicidin LL-37 was measured by ELISA in patients with myocardial infarction (MI, n = 172) and normal controls ( n = 160). b The serum level of LL-37 was measured by ELISA in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. c The serum LL-37/neutrophil ratio was determined in MI patients with cardiovascular readmission and/or death ( n = 27) compared to those without readmission and/or death ( n = 53) during the 1-year follow-up. d The receiver-operator characteristic (ROC) curve was used to assess the sensitivity and specificity of the serum LL-37/neutrophil ratio in prediction of readmission and/or death in MI patients. Data were expressed as mean ± SEM. * P < 0.05; ** P < 0.01; *** P < 0.001

    Article Snippet: Supernatants from human samples were taken for measurement of the serum level of LL-37 using the human cathelicidin antimicrobial peptide (LL-37) ELISA kit (CUSABIO, CSB-EL004476HU) according to the manufacturer’s instructions.

    Techniques: Enzyme-linked Immunosorbent Assay